missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human beta COP (aa 743-844) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP102953
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described.Specifications
| P53618 | |
| Blocking Assay, Control | |
| 1315 | |
| 100 μL | |
| 2610019B04Rik; beta coat protein; beta-coat protein; Beta-COP; coatomer protein complex subunit beta 1; coatomer protein complex, subunit beta 1; Coatomer subunit beta; COPB; COPB1; DKFZp761K102; FLJ10341; FLJ46444; FLJ57957; I79_013776; MSTP026; Rack2; receptor for activated C-kinase-2 | |
| Copb1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human beta COP (aa 743-844) Control Fragment | |
| RUO | |
| beta COP | |
| Unconjugated | |
| Recombinant | |
| VLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVASTENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQMW | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |