missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DPPA2 (aa 102-183) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP96402
Description
Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57536 (PA5-57536. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
DPPA2 may play a role in maintaining cell pluripotentiality. ECSA/DPPA2 is a promising target for antigen-specific immunotherapy in non-small cell lung cancers.Specifications
| Q7Z7J5 | |
| Blocking Assay, Control | |
| 151871 | |
| 100 μL | |
| 2410088E07Rik; C80932; cancer/testis antigen 100; CT100; D19Mgi18; developmental pluripotency associated 2; developmental pluripotency-associated 2; developmental pluripotency-associated protein 2; DPPA2; ECAT15-2; ECSA; embryonic stem cell (ESC) associated transcript 15-2; embryonic stem cell-associated transcript 15-2 protein; LOC683282; PESCRG1; Phsecrg1; Pluripotent embryonic stem cell-related gene 1 protein; similar to developmental pluripotency-associated 2 | |
| DPPA2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human DPPA2 (aa 102-183) Control Fragment | |
| RUO | |
| DPPA2 | |
| Unconjugated | |
| Recombinant | |
| DWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPG | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |