missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human eIF3b (aa 708-795) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP103041
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83941 (PA5-83941. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:9388245, PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed:9388245, PubMed:17581632). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed:25849773). [UniProt]Specifications
| P55884 | |
| Blocking Assay, Control | |
| 8662 | |
| 100 μL | |
| AL033316; AL033334; AL033369; AW208965; D5Wsu45e; eIF3 p110; eIF3 p116; EIF3B; eIF3b {ECO:0000255; eIF-3-eta; EIF3-ETA; eIF-3-eta {ECO:0000255; EIF3-P110; EIF3-P116; EIF3S9; eukaryotic translation initiation factor 3 subunit 9; eukaryotic translation initiation factor 3 subunit 9 {ECO:0000255; Eukaryotic translation initiation factor 3 subunit B; eukaryotic translation initiation factor 3 subunit B {ECO:0000255; eukaryotic translation initiation factor 3, subunit 9 (eta); eukaryotic translation initiation factor 3, subunit 9 (eta, 116 kD); eukaryotic translation initiation factor 3, subunit 9 eta, 116 kDa; eukaryotic translation initiation factor 3, subunit B; HAMAP-Rule:MF_03001}; hPrt1; MGC104664; MGC131875; PRT1; Prt1 homolog | |
| EIF3B | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human eIF3b (aa 708-795) Control Fragment | |
| RUO | |
| eIF3b | |
| Unconjugated | |
| Recombinant | |
| PPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |